Protein Info for Rv2924c in Mycobacterium tuberculosis H37Rv

Annotation: Probable formamidopyrimidine-DNA glycosylase Fpg (FAPY-DNA glycosylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR00577: DNA-formamidopyrimidine glycosylase" amino acids 1 to 284 (284 residues), 341.6 bits, see alignment E=1.6e-106 PF01149: Fapy_DNA_glyco" amino acids 1 to 124 (124 residues), 126.3 bits, see alignment E=1.5e-40 PF06831: H2TH" amino acids 144 to 231 (88 residues), 100.4 bits, see alignment E=7.1e-33 PF06827: zf-FPG_IleRS" amino acids 257 to 286 (30 residues), 33.3 bits, see alignment (E = 5e-12)

Best Hits

Swiss-Prot: 100% identical to FPG_MYCTA: Formamidopyrimidine-DNA glycosylase (mutM) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K10563, formamidopyrimidine-DNA glycosylase [EC: 3.2.2.23 4.2.99.18] (inferred from 100% identity to mtb:TBMG_01047)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.23, 4.2.99.18

Use Curated BLAST to search for 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>Rv2924c Probable formamidopyrimidine-DNA glycosylase Fpg (FAPY-DNA glycosylase) (Mycobacterium tuberculosis H37Rv)
MPELPEVEVVRRGLQAHVTGRTITEVRVHHPRAVRRHDAGPADLTARLRGARINGTDRRG
KYLWLTLNTAGVHRPTDTALVVHLGMSGQMLLGAVPCAAHVRISALLDDGTVLSFADQRT
FGGWLLADLVTVDGSVVPVPVAHLARDPLDPRFDCDAVVKVLRRKHSELKRQLLDQRVVS
GIGNIYADEALWRAKVNGAHVAATLRCRRLGAVLHAAADVMREALAKGGTSFDSLYVNVN
GESGYFERSLDAYGREGENCRRCGAVIRRERFMNRSSFYCPRCQPRPRK