Protein Info for Rv2791c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF12323: HTH_OrfB_IS605" amino acids 11 to 48 (38 residues), 41.8 bits, see alignment 8.7e-15 PF01385: OrfB_IS605" amino acids 203 to 321 (119 residues), 104.3 bits, see alignment E=7.5e-34 PF07282: Cas12f1-like_TNB" amino acids 344 to 405 (62 residues), 57.9 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 82% identical to Y2885_MYCTO: Putative transposase MT2953 (MT2953) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K07496, putative transposase (inferred from 100% identity to mtc:MT2861)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>Rv2791c Probable transposase (Mycobacterium tuberculosis H37Rv)
MAKFEIPEGWMVQAFRFTLDPTAEQARALARHFGARRKAYNWTVATLKADIDAWQATGIQ
TAKPSLRVLRKRWNTVKNDVCVNIETGVVWWPECSKEAYADGIDGAVDAYWNWQNSRSGK
RDGKRMGFPRFKKKGRDPDRVTFTTGAMRVEPDRRHLTLPVIGTVRTHENTRRVERLIAK
GRSRVLAITVRRNGTRIDASVRVLVQRPQQPKVTDPGSRVGVDVGVRRLATVATADGAVL
ERVPNPRPLDAALNELRHVCRARSRCTKGSRRYRERTTEISRLHRRVNDVRTHHLHCLTT
HLAKTHGRIVVEGLDAAGMLRQQGLSGARARRRGLSDAALGTPRRHLSYKTGWYGSQLVV
ADRWFPSSKTCHVCGHVQEIGWAEHWQCDSCSASHQRDDCAAINLARYEDTSSVVGPVGA
AVKRGADRKTRPGRAGGREARKGSSRKAAEQPRDGVQVA