Protein Info for Rv2039c in Mycobacterium tuberculosis H37Rv

Annotation: Probable sugar-transport integral membrane protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 273 (179 residues), 68.9 bits, see alignment E=2.5e-23

Best Hits

Swiss-Prot: 34% identical to YESQ_BACSU: Probable ABC transporter permease protein YesQ (yesQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 99% identity to mtf:TBFG_12076)

Predicted SEED Role

"Probable sugar-transport integral membrane protein ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>Rv2039c Probable sugar-transport integral membrane protein ABC transporter (Mycobacterium tuberculosis H37Rv)
VGWADRIVHRHFIRGLALYAGLIGIAWCALFPIIWALSGSLKADGEVTEPTLFPSHPQWS
NYREVFALMPFWRMFFNTVLYAGCVTAGQVFFCSLAGYAFARLQFRGRDTLFVLYLSTLM
VPLTVTVIPQVILMRIVGWVDTPWAMIVPGLFGSAFGTYLMRQFFRTLPTDLEEAAILDG
CSPWQIYWRILLPHSRPAVLVLGVLTWVNVWNDFLWPLLMIQRNSLATLTLGLVRLRGEY
VARWPVLMAASMLMLVPLVILYAVAQRSFVRGIAVTGLGG