Protein Info for Pf6N2E2_833 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable Co/Zn/Cd efflux system membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 3 to 301 (299 residues), 193.3 bits, see alignment E=2.7e-61 PF16576: HlyD_D23" amino acids 7 to 206 (200 residues), 54 bits, see alignment E=2.8e-18 PF13533: Biotin_lipoyl_2" amino acids 12 to 53 (42 residues), 30.3 bits, see alignment 5.6e-11 PF13437: HlyD_3" amino acids 117 to 208 (92 residues), 38 bits, see alignment E=4.7e-13

Best Hits

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_a3064)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YWW3 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Pf6N2E2_833 Probable Co/Zn/Cd efflux system membrane fusion protein (Pseudomonas fluorescens FW300-N2E2)
VAARVQSDLGFRVSGKVLERLVDAGQAVKKGQPLMRLDPIDLGLQARAQQEAVTAARARA
KQTADDEARYRELVAAGAISASGYDQIKAAADTAKAQLSAAEAQADVARNASGYAVLLAD
ADGVVMETLAEPGQVVSPGQPVVRLARAGQREAVVQLPETLRPAVGSSAQATLYGSTSGA
VTARLRLLSDSADRVTRTFEARYVLEGALANAPLGSTVTLRIAEGVAQGPVLQVPIAALY
DPGNGTGVWVIDGEPAKVTWRPVQVLGLSDDAARVAGRLNVGERIVALGAHLLREGEPVR
LLAPGDVNIAGTRQ