Protein Info for Pf6N2E2_3748 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 5 to 166 (162 residues), 73.8 bits, see alignment E=8.1e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A059 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Pf6N2E2_3748 Cytochrome B561 (Pseudomonas fluorescens FW300-N2E2)
MHSNYSKRRVLLHWLSAVIILWTLVSGFYVAFNPVSASTEHWIGSLNVSLTTLFIPFFVW
RAWLFFCELEPRGAALSLNKKLALVVHALIYLTIGVVLVTGVLMMKSTISVFGLVRFPQP
LADPALIELANTLHSLSCVVLSMLIALHLCAVLWHEFSGRRVVRRMSFAKPAGAMSRRAQ
R