Protein Info for Pf6N2E2_321 in Pseudomonas fluorescens FW300-N2E2

Annotation: TRAP transporter solute receptor, unknown substrate 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 4 to 314 (311 residues), 372.3 bits, see alignment E=8.1e-116 PF16868: NMT1_3" amino acids 31 to 314 (284 residues), 314.7 bits, see alignment E=1.2e-97 PF12974: Phosphonate-bd" amino acids 75 to 170 (96 residues), 28.4 bits, see alignment E=1.6e-10 PF09084: NMT1" amino acids 105 to 233 (129 residues), 31.5 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: K07080, (no description) (inferred from 98% identity to pba:PSEBR_a3538)

Predicted SEED Role

"TRAP transporter solute receptor, unknown substrate 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YRZ8 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Pf6N2E2_321 TRAP transporter solute receptor, unknown substrate 1 (Pseudomonas fluorescens FW300-N2E2)
MRVNKHFTLLAAAAALVVSTTAQAAPVYINILTGGTSGVYYPIGVGLSQIYSSGIQDAKT
SVQATKASVENLNLLQAGRGELALALGDSVADAKNGVEDAGFKAPLTKLRAIAGAYPNYI
QIVASQESGIKTLADLKGKTVSVGAAKSGTELNARAIFKAAGLTYQDMKVQYLPFAESVD
LIKNRQLDATLQSSGLGMAAIRDLASTMALSYVAVPTDVVEKIGNPAYQSAMIPANTYDG
QAEAVPTVAITNILVTREDVPDEVAYQMTKLLFENLTRLGTSHSAAKDITLKNAAKNLPI
ALHPGAERYYKEVGAL