Protein Info for Pf6N2E2_1436 in Pseudomonas fluorescens FW300-N2E2

Annotation: FMN reductase (EC 1.5.1.29)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 6 to 148 (143 residues), 104.9 bits, E=3.1e-34
• PF02525: Flavodoxin_2
  • amino acids 6 to 136 (131 residues), 36.5 bits, E=4.2e-13
• TIGR03566: FMN reductase
  • amino acids 6 to 173 (168 residues), 250 bits, E=5.8e-79

Best Hits

Swiss-Prot: 60% identical to MSUE_PSEAE: FMN reductase (NADPH) (msuE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 95% identity to pba:PSEBR_a2614)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• two-component alkanesulfonate monooxygenase (2/2 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (2/3 steps found)
• bacterial bioluminescence (4/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.29

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

See A0A159ZXD6 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Pf6N2E2_1436 FMN reductase (EC 1.5.1.29) (Pseudomonas fluorescens FW300-N2E2)
MSKQFKVVAVSGSVQHPSRTLTLLQALVERLGQQLPIEVRLIELAKVGPQFAGVLRREAL
PAAVQEDLHAIESADLLIAASPVYRASYTGLFKHLFDFVHHEALKNVPVLLAATGGSDRH
ALMIDHQLRPLFGFFQALSLPVGVYASEADFSQYRICSAQVLERIERAVESALLSLVPSV
RRDASAA