Protein Info for MPMX20_01854 in Enterobacter sp. TBS_079

Annotation: NADP-specific glutamate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF02812: ELFV_dehydrog_N" amino acids 57 to 184 (128 residues), 171.1 bits, see alignment E=9.1e-55 PF00208: ELFV_dehydrog" amino acids 202 to 445 (244 residues), 297.2 bits, see alignment E=1e-92

Best Hits

Swiss-Prot: 92% identical to DHE4_SALTY: NADP-specific glutamate dehydrogenase (gdhA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00262, glutamate dehydrogenase (NADP+) [EC: 1.4.1.4] (inferred from 96% identity to enc:ECL_02460)

MetaCyc: 90% identical to glutamate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glutamate dehydrogenase (NADP(+)). [EC: 1.4.1.4]

Predicted SEED Role

"NADP-specific glutamate dehydrogenase (EC 1.4.1.4)" in subsystem Arginine and Ornithine Degradation or Glutamate dehydrogenases or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Proline Synthesis (EC 1.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>MPMX20_01854 NADP-specific glutamate dehydrogenase (Enterobacter sp. TBS_079)
MDQTRSLETFLSYVQQRDPHQSEFAQAVREVMTTLWPFLEENPRYRQMSLLERLVEPERV
IQFRVTWVDDRNQVQVNRAWRVQFNSAIGPFKGGMRFHPSVNLSILKFLGFEQTFKNALT
TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGPDTDVPAGDIGVGAREVGFMA
GMMKKLSNNSACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGLGFEGMRVAVSGS
GNVAQYAIEKAMQFGARVVTASDSRGTVVDEAGFTAEKLARLCDIKASRDGRLADYAREF
GLTWLEGKQPWGVPVDIALPCATQNELDTEAARTLITNGVKAMAEGANMPTTIEATDLFL
EAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEYGGEA
SQTNYVRGANIAGFVKVADAMMGQGVI