Protein Info for MPMX20_00455 in Enterobacter sp. TBS_079

Annotation: Modulator of FtsH protease HflK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 78 to 100 (23 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 60 (60 residues), 59.9 bits, see alignment E=1.8e-20 TIGR01933: HflK protein" amino acids 97 to 357 (261 residues), 415.2 bits, see alignment E=5.3e-129 PF01145: Band_7" amino acids 99 to 270 (172 residues), 111.8 bits, see alignment E=4.2e-36

Best Hits

Swiss-Prot: 90% identical to HFLK_ECOLI: Modulator of FtsH protease HflK (hflK) from Escherichia coli (strain K12)

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 96% identity to enc:ECL_00572)

MetaCyc: 90% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>MPMX20_00455 Modulator of FtsH protease HflK (Enterobacter sp. TBS_079)
MAWNQPGNNGQDRDPWGSSNNQGGNSGGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGK
GSGSGGGSTQGPRPQLGGRVVGIVAAAVVIIWAASGFYTIKEAERGVVTRFGKFSHLVEP
GLNWKPTFIDDVTAVNVESVRELAASGVMLTSDENVVRVEMNVQYRVTDPQHYLFSVTSA
DDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMGITLLDVNFQA
ARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKTQTVLE
AQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKGGNLMVLPLDQML
KGGSAPAAKADTSGANNLLRLPPAASGSSSATTTPSSNDGDIMDQRRANAQRNDYQRQGE