Protein Info for MPMX19_06004 in Azospirillum sp. SherDot2

Annotation: Lipopolysaccharide export system ATP-binding protein LptB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF00005: ABC_tran" amino acids 32 to 200 (169 residues), 93.7 bits, see alignment E=2.4e-30 PF12399: BCA_ABC_TP_C" amino acids 255 to 280 (26 residues), 44.8 bits, see alignment (E = 1e-15)

Best Hits

Swiss-Prot: 55% identical to LIVG_SALTY: High-affinity branched-chain amino acid transport ATP-binding protein LivG (livG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 95% identity to azl:AZL_e02740)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>MPMX19_06004 Lipopolysaccharide export system ATP-binding protein LptB (Azospirillum sp. SherDot2)
MSAPMNTVGLTEKPLLSVEHLTMRFGGLVANNDVSFEARAGEITALIGPNGAGKTTLFNC
VTGFYTPTVGRLTLRHPAGKEFLLERMPGYRIAQLAGVARTFQNIRLFSGMSVLENLIVA
QHNKLMRASGFAIAGLLGLPGFRKAEHEAVELAKYWLDRVRLTEFADWEAGNLPYGAQRR
LEIARAMCTEPVLLCLDEPAAGLNPRESGELAEILTFIRDVQTPQGHRTGVLLIEHDMSV
VMRISDHVVVLDYGRKISDGTPEHVKNDPAVIRAYLGEDEDEALPPEIAADLNMPQEAQK
GA