Protein Info for MPMX19_04609 in Azospirillum sp. SherDot2

Annotation: Putative short-chain type dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00106: adh_short" amino acids 18 to 214 (197 residues), 153 bits, see alignment E=1.1e-48 PF08659: KR" amino acids 21 to 193 (173 residues), 74 bits, see alignment E=2.2e-24 PF13561: adh_short_C2" amino acids 24 to 238 (215 residues), 122.5 bits, see alignment E=3.3e-39

Best Hits

KEGG orthology group: None (inferred from 61% identity to sil:SPO1965)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>MPMX19_04609 Putative short-chain type dehydrogenase/reductase (Azospirillum sp. SherDot2)
MSIQSNEIGPDGIRFDGRVAIVTGAGNGLGRGYALQLAARGARVVVNDLGGGRDGRGASD
AAETVVAEIHSRGGEAIADGANVTDPAQVAAMVERTIGLWGRIDVLINNAGILRDKSFAK
MELEDFRSVVDVHLMGAANVTHAVWPIMRAQGYGRVLMTTSTSGVYGNFGQSNYGAAKAG
LVGLMNVLHLEGIRNGIHVNAVAPTAATRMTSDILDETALARLNPDFVTPAALFLVSEQA
PSRTVILAGAGTYARLAIVESDGVFLPEGERTPEAVAARFAEIASLDRQHEIDAGLSHVD
RILKRAADAAG