Protein Info for MPMX19_04229 in Azospirillum sp. SherDot2

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 821 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 457 to 478 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 426 to 549 (124 residues), 61 bits, see alignment E=6.1e-21 PF13188: PAS_8" amino acids 429 to 468 (40 residues), 22.7 bits, see alignment 1.5e-08 PF13426: PAS_9" amino acids 441 to 540 (100 residues), 34.5 bits, see alignment E=4.2e-12 PF08448: PAS_4" amino acids 442 to 542 (101 residues), 24 bits, see alignment E=7.5e-09 PF02518: HATPase_c" amino acids 708 to 816 (109 residues), 90.2 bits, see alignment E=2.4e-29

Best Hits

KEGG orthology group: None (inferred from 88% identity to azl:AZL_a05540)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (821 amino acids)

>MPMX19_04229 Adaptive-response sensory-kinase SasA (Azospirillum sp. SherDot2)
MDGLSSTALPASDAVVIDNTARRMPQTPPPKRRRRFGIALRITLGLSVMALLVLLIGGVS
MSSFRLFRAEVAALSTNTLPEVITSAELHGSLQKLVAQLPQLAAAASTPQRRSIYDGLVT
ELDSMQLLVARMRGLMKEGDPGAGERDGNVRLLEQTRSTLLILAATVADLNAEVTRQIDY
GDRQAEAARALSRLAAAIESMPDTGAWAARIGALMARAAGATQLDHLSRLKGEARSAERT
LAELARLSGGAPDPTGQMMSTVQEELFSLLVAPGGLFESAIDRLQARNRAQALTGQAQVL
VETVERSTRALYDSIRDQSAERTDALAALIAERTRTVMVLAATSLLLAVCVYFFFRRFLS
TRLVAMNRAVLARLSGNRQPPHCGMAAPAGLPVPVPVDGDDEITDIGASIRYFIEEIDRR
QQALADNERRFRDLVEGSIQGIVIHRDFHVLYANDSFAAMLGMTVAEVVALPSLLSVVAA
TERQALIEGYDRLLENGQSTPRRRIRACRSDGAGLWVELTGRRIDWMDGPAIQAVVVDVT
REVEAEHALRQSRDAAERALDELKATQASLIQAEKMASLGQLVAGVAHEVNTPIGITITG
ASQLQTLIGELSDRHTANALKKSDFQRFLSDGMEMASLILSNSTRAANLVQSFKLVAVDQ
SSDERRPFLLRDYIDELLRSLHPTYKARTALTIDVACPADLELDGYPGALSQILTNLIMN
ALVHALDPEQPGRIAIAARTLGPDMVELSVGDDGNGIAPDVLPKIFDPFFTTRRGAGGSG
LGLHIVYNLVTGRLHGTIGVESHPGEGTRFTLRFPRVTATA