Protein Info for MPMX19_04005 in Azospirillum sp. SherDot2

Annotation: Glutathione-binding protein GsiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00496: SBP_bac_5" amino acids 68 to 422 (355 residues), 327.5 bits, see alignment E=5.8e-102

Best Hits

Swiss-Prot: 48% identical to GSIB_SHIF8: Glutathione-binding protein GsiB (gsiB) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K13889, glutathione transport system substrate-binding protein (inferred from 97% identity to azl:AZL_a08300)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>MPMX19_04005 Glutathione-binding protein GsiB (Azospirillum sp. SherDot2)
MNRFALPLLAGLLAGTALAGPAFAAKDLVVGLPDNITTLDPADINDTLSQSASRTMLQGL
FGFDKDMKLVPLLAESFTVNDTATEYTYRLRKNVAFHDGTPFNAQAVKTNFDRLANPANR
LKRQSLLAMLAETVVVDDYTITLKLSQPFGALNNNLAHPGAMIHSPKALETFGKEIGRHP
VGTGPYKFVSWEADTLKVEKNDKYWKPGLPKIDHVTLKSVPENGSRIAMLQTNEAQFIYP
LPPEMVKMVEANNQLELIDAPSIIARYVAMNTMKKPFNDPRVRQALNYAVDKNAYAKVVY
RGYAGPLDSAIPSKLGFHVAQPNQYTYDLAKAKALLAEAGYPNGFEAEMFGRNSTNFIRG
MQFVQQQLSQIGVKLTVTPLESGVETARVWGVEKPEDATVQMQYGGWSASTGDADWGLRP
LLWGKGFPPKFFNVAYYKNDTVDAAIETGIGTADTAKRAEAYRVAQEQIWKDAPWIFLGV
ENLLAGKSKKLTGFYYVADGGLQMEEADLQ