Protein Info for MPMX19_03378 in Azospirillum sp. SherDot2

Annotation: Galactose/methyl galactoside import ATP-binding protein MglA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 PF00005: ABC_tran" amino acids 22 to 171 (150 residues), 105.1 bits, see alignment E=4.7e-34 amino acids 270 to 424 (155 residues), 67.1 bits, see alignment E=2.5e-22

Best Hits

Swiss-Prot: 42% identical to RGMG2_BURCM: Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 (Bamb_1305) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 91% identity to azl:AZL_a02400)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>MPMX19_03378 Galactose/methyl galactoside import ATP-binding protein MglA (Azospirillum sp. SherDot2)
MSPPILIRTVALTKRYPGVTALDRVDFDLHAGEVHVLFGENGAGKSTLISLLAGVSVPSE
GEILVRGHHARFTGVADARAAGISAVFQEFSLVPTLTVAENLFLGDEPRKGPFLDRRAMR
RKAAALFADLDFAIDPRRLVATLSRAEQQMVEIAKALHGEVGILILDEPTASLTDREVDH
LFAVIARMKARGVGIVYISHRMQEFARIADRVTVLRDGRRIGTVAMADTSEAALLEMMAG
RAIAEIYPSIARNPGEVLLRMEGLHAWGVHGVDLEVRAGEVLGVAGLVGSGKSRSFRALM
GLLPVQAGRVTVRGRDVTGASTRDLMRAGLCYVPPDRKTEGLQLAFSTRDNLAQGELAGT
PSRFGLLPWPRIRRRCEATAERVELPVTYRGRAAGQLSGGNQQKALFGRALGRDYDLYIF
DEPTVGVDMGARAAIYRLIRELAEAGKAVVVISSDLPEAMNLAHRLAVFAHGRIAAELEG
DAIGEAAILSHFFDPVPSASAPSVPAIDQEARLPA