Protein Info for MPMX19_02668 in Azospirillum sp. SherDot2

Annotation: RNA polymerase sigma-54 factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 TIGR02395: RNA polymerase sigma-54 factor" amino acids 1 to 515 (515 residues), 409.1 bits, see alignment E=1.2e-126 PF00309: Sigma54_AID" amino acids 1 to 34 (34 residues), 50.2 bits, see alignment (E = 2.8e-17) PF04963: Sigma54_CBD" amino acids 154 to 342 (189 residues), 169.2 bits, see alignment E=1.2e-53 PF04552: Sigma54_DBD" amino acids 357 to 516 (160 residues), 230 bits, see alignment E=1.9e-72

Best Hits

Swiss-Prot: 54% identical to RP54_SINFN: RNA polymerase sigma-54 factor (rpoN) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 95% identity to azl:AZL_001090)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>MPMX19_02668 RNA polymerase sigma-54 factor 2 (Azospirillum sp. SherDot2)
MTPQLQQAIKLLQLSNIELSDFVDREIEQNPLLERDGGSADGGSDPVGPADGSDAPGGLD
GPGGMAANGLSADGLNGRDDGPALPTGDGRTRDTVEMTSSDTMTSSSESPLDTDFENVYG
DDRFSDGSDGGSEVYGSYGERGGRSGFEDDDSNLEATLTSEKNLRDHLTEQLKIDLPDLG
DQLIGLALIDMLDEAGWLIGFDAQAMAEQLGCGAERVERVLTACQRFDPPGIFARSLKEC
LAIQLREKNRLDPAMAALLDNLELLAARNLPAIMKVCGVDAEDVADMVVDIRKLNPKPAL
AFDHTPAQLVTPDILMRANPGGGWLIDLNPDTLPRVLVNHRYFARISDGARNKADKEYIS
ERFQSANWLVKSLHQRATTILKVASEIIRQQDAFFIHGVSHLRPLILRDIAEAIGMHEST
VSRVTTNKFMATPRGVFELKYFFTSAIQGADGQASHSAEAVRHRIKTMIDAEKPDDVLSD
DKLVEILRAEGIDIARRTVAKYREAMKIPSSVQRRRAKMSRM