Protein Info for MMJJ_RS07715 in Methanococcus maripaludis JJ

Annotation: UbiD family decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR00148: decarboxylase, UbiD family" amino acids 14 to 406 (393 residues), 415.3 bits, see alignment E=1.4e-128 PF01977: UbiD" amino acids 96 to 276 (181 residues), 178.3 bits, see alignment E=1.2e-56 PF20696: UbiD_C" amino acids 281 to 404 (124 residues), 124.3 bits, see alignment E=3.1e-40

Best Hits

KEGG orthology group: None (inferred from 99% identity to mmp:MMP1288)

Predicted SEED Role

"UbiD family decarboxylase, MJ1133 type"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>MMJJ_RS07715 UbiD family decarboxylase (Methanococcus maripaludis JJ)
MVKNLVNSIEKLVFEKSTKKFGVSRILKENDDKPVFIKDVNGYPVIGNLCTREVIAESLG
IEKEDLMKHMVESMNNEKNGELIVDESLEKLYIDDDLEKIHEYPIPTYYGKDAGPYLTSG
VVIVKDKDEGVNASIHRILVRPDGNLAIRMVEQRHLHYIYNKNIGNGEVDCAIVIGVHPA
VLLAASTSGDVSFNELKYASALMNKPLNLVKCKTVDLEVPEAEFIIEAKITAEMVDEGPF
VDITGTYDVIRKQPLIKVTALRRKEDAIFHALLPGGSEHKLLMGIPQEPRMYKGIRNTVP
SLKNVALTQGGCCWLNAVVSIDKKTEGDGKNAILAALAAHPSLKHVTVVDDDINIYDAND
VEYAVATRVQSDKDIIIIPGAKGSSLDPSADHKNKLTAKMGIDATMSLLKGKEEFIRAEV
PKDDE