Protein Info for MMJJ_RS07430 in Methanococcus maripaludis JJ

Annotation: ribonuclease VapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF18477: PIN_9" amino acids 4 to 120 (117 residues), 61.7 bits, see alignment E=1.1e-20 PF04900: Fcf1" amino acids 33 to 121 (89 residues), 37.7 bits, see alignment E=3.3e-13

Best Hits

Swiss-Prot: 48% identical to VAPC4_METJA: Ribonuclease VapC4 (vapC4) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07158, (no description) (inferred from 93% identity to mmx:MmarC6_1331)

Predicted SEED Role

"Nucleotide binding protein, PINc"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>MMJJ_RS07430 ribonuclease VapC (Methanococcus maripaludis JJ)
MYRVIPDTNFLIYAFKQGINFEYELNIAIDRGYKIYIMDCVLKELEKLKLEFKGKEKLSV
NIALKYAKNFEIIEYSNGKYADEMILNYSNENKDVIICTNDKKLKKDLIDIGTPIILVKQ
HNHFELQGYLK