Protein Info for MMJJ_RS04685 in Methanococcus maripaludis JJ

Annotation: carbamoyltransferase HypF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 PF00708: Acylphosphatase" amino acids 5 to 91 (87 residues), 78.5 bits, see alignment E=1.2e-25 TIGR00143: carbamoyltransferase HypF" amino acids 6 to 764 (759 residues), 944 bits, see alignment E=2.7e-288 PF07503: zf-HYPF" amino acids 112 to 145 (34 residues), 55.8 bits, see alignment (E = 9.6e-19) amino acids 162 to 194 (33 residues), 51.7 bits, see alignment (E = 1.9e-17) PF01300: Sua5_yciO_yrdC" amino acids 212 to 387 (176 residues), 121.3 bits, see alignment E=9.9e-39 PF17788: HypF_C" amino acids 405 to 506 (102 residues), 85.7 bits, see alignment E=9.3e-28 PF22521: HypF_C_2" amino acids 516 to 762 (247 residues), 222.8 bits, see alignment E=1.7e-69

Best Hits

Swiss-Prot: 64% identical to HYPF_METJA: Probable carbamoyltransferase HypF (hypF) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04656, hydrogenase maturation protein HypF (inferred from 96% identity to mmp:MMP0140)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (771 amino acids)

>MMJJ_RS04685 carbamoyltransferase HypF (Methanococcus maripaludis JJ)
MTAKRIDVKGIVQGVGFRPFVYRIAKKNDLNGYVKNMGNYVEIVVSGKLNNIDAFLSDLK
LEKPPLSKIDNISIEDIDENENLNEIYNDFTIKLSDTSEIEEEGTIPPDISICDECLKEI
MDKKDRRSNYAFTACTNCGPRFTVIEKLPYDRENTSMNDFPLCKSCIEEYKNPEDRRFHA
QATCCDICGPELFITDTSGKIISNDICDAVKFLENGKILAIKGIGGTHLVCSINSDKSVL
ELRKRLNRPTQAFAVMSREEYLDLFSKIDKNELNTIKSAKKPIVALKKNESYEKYFSKHV
SNLNTIGVMLPYSGLHYLLFENTDQIAYIMTSANLPGLPMSIDNDQILEKLENIADYFLL
HNRKIVNRCDDSVLKEINGKMELLRRSRGFAPEPVEVNYEKIKKSSKNILALGPELNSVA
CLVKNNKFYLTQYIGNTGKYETFNYLKDAVENLIKITNTNKIDAVVCDLHPSFNSTLFAN
ELGEKYQIPVTQVQHHESHCYSLMGDSDIFENNVTIAIDGLGYGNDGNIWGGEVFLFKNG
KIERAGHLEEQIQPGADLASKYPLRMLASILNKANLNVSEIIKKYNYFSEKELKLILFQL
EKNINVSKTTSTGRVLDSISALVSLCFERTYDGEPSIRLEALANEYTGEISEIEKLVEES
IKIENNILDTTSLVVKSLKMLNNNEKIEKIAYFIHVAIADGLSKIAIETAKKQSIEYIGI
TGGVSYNKIISERIVENIKKESLKPLIHERIPNGDGGISFGQAIGYLLNSN