Protein Info for MMJJ_RS00275 in Methanococcus maripaludis JJ

Annotation: coenzyme F420-0:L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR01916: coenzyme F420-0:L-glutamate ligase" amino acids 9 to 248 (240 residues), 307.6 bits, see alignment E=2.9e-96 PF01996: F420_ligase" amino acids 14 to 225 (212 residues), 243.7 bits, see alignment E=8.2e-77

Best Hits

Swiss-Prot: 99% identical to COFE_METMP: Coenzyme F420:L-glutamate ligase (cofE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K12234, coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC: 6.3.2.31 6.3.2.34] (inferred from 99% identity to mmp:MMP0937)

MetaCyc: 71% identical to F420-0:gamma-glutamyl ligase subunit (Methanocaldococcus jannaschii)
RXN-8081 [EC: 6.3.2.34]; RXN-8080 [EC: 6.3.2.34, 6.3.2.31]

Predicted SEED Role

"Coenzyme F420-0:L-glutamate ligase @ Coenzyme F420-1:L-glutamate ligase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.31 or 6.3.2.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>MMJJ_RS00275 coenzyme F420-0:L-glutamate ligase (Methanococcus maripaludis JJ)
MIKERVKMDVIGLEIPLISGNEDYTLAELISTYPLEDKDVIVIAETVVSKIEKNVILKNE
ITPSNEAMELSKKLGKEPEVVQVILDESNEIVKLGPNFIITETKHGFVCANSGVDESNTS
KGIKPLPKNPDKSAEEIRMGLEKITGKKVGVIINDSMGRPFRKGSCGIAIGISGVCGLWD
RKGEKDLFGRELKTTEVGIADELAATASAVMGQSNEGIPLVIIRNAPVPFTNGTGKELIR
KKEEDVFR