Protein Info for MIT1002_02455 in Alteromonas macleodii MIT1002

Annotation: Methyl-accepting chemotaxis protein 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 284 to 306 (23 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 30 to 246 (217 residues), 147.5 bits, see alignment E=1.3e-46 PF17203: sCache_3_2" amino acids 94 to 203 (110 residues), 33.6 bits, see alignment E=1e-11 PF17202: sCache_3_3" amino acids 105 to 203 (99 residues), 98.1 bits, see alignment E=9.5e-32 PF00672: HAMP" amino acids 312 to 359 (48 residues), 32.5 bits, see alignment 2.3e-11 PF00015: MCPsignal" amino acids 443 to 605 (163 residues), 141.8 bits, see alignment E=5e-45

Best Hits

KEGG orthology group: None (inferred from 86% identity to amc:MADE_01222)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (639 amino acids)

>MIT1002_02455 Methyl-accepting chemotaxis protein 4 (Alteromonas macleodii MIT1002)
MSIQRKFLFSISAVIALFALIVAVATVITTSSNVSTLVQEQKKNTADRLVNILTVTDSIM
LERVKSSMALLKQRGEAIGEPNQTDIVTVKNTQARQLRLGNAEQANTFDLVDNLTSVMGG
TATLFSKTGDDYIRVSTNVIKNGERAIGTKLAPDGKAIKKINQQEAYYGAVDILGSPYLT
GYEPMFNSSGDVVGIWYVGYSADLNVLEQAIKQSHVLKEGFVALRDAKGNIRMHSAHVND
RQVANALQPNDDWVVEVVPFSPWGYDIILVASTSEKSAMVRSSVLVVVLKIVLASVGILI
TIWLLVKYIVGKPLEEFIGVVNNLSSGEGDLTFRFQASRSDEFGTMARAFNGLLSQLQDT
LQSVDEATDHMLAKSERLNATALQSKDTVSQLSRETESINNAISLMQQNAQTVSSTIRSS
SEAAHAADQDTRNSVSVLAQTIKDIQSQASDVDASVQVITELAQASEEISGVMEVIRNIA
EQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTQSSTEEIRNMIERLQQGSRVAS
EKMQQNKETAYKTVDTTKHAGDSLKQALDAVARITTLNRDAATMAEGQTEVANDVNKGVS
SIQQVGNANTTYAKEVVDNCEALVQQVKQMQMQLLRYHF