Protein Info for LU632_RS21940 in Erwinia tracheiphila SCR3

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF13439: Glyco_transf_4" amino acids 15 to 186 (172 residues), 51.2 bits, see alignment E=3.2e-17 PF13579: Glyco_trans_4_4" amino acids 15 to 181 (167 residues), 30.8 bits, see alignment E=7.2e-11 PF00534: Glycos_transf_1" amino acids 200 to 342 (143 residues), 84.4 bits, see alignment E=1.5e-27 PF13692: Glyco_trans_1_4" amino acids 203 to 340 (138 residues), 80.4 bits, see alignment E=3.3e-26

Best Hits

KEGG orthology group: None (inferred from 72% identity to ebi:EbC_00720)

Predicted SEED Role

"Lipopolysaccharide core biosynthesis glycosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>LU632_RS21940 glycosyltransferase (Erwinia tracheiphila SCR3)
MSNRILMIIDGLPGGGAEKVVLTLASGLIDCGHHVSLFSLRDVCDYPIPDGLHYLVIKDD
CKKPWRKLTELSRRAALLNQAIIETEQASGHFDLVVSHLHKTDRIVRRCDALFSAKTWFC
LHGVFSASYLTQRKGFSLWLKKAKTKKVYENRNVLGVSQYVIDDLKQAFRVHPAREVVIY
NPFDFDAVRQQSLKPCKMAGEDYLVHVGRFHQTKRHDRLLRAYAKSGLTAPLVLIGQGSD
DIKERLKKLAIELAISERVIFKGFTSNPYPWIRNARMLVVSSDSEGFGNVLVEALICHTP
VVSTRCPGGPTTILTGELARGLAEMNDDSLAATMKEIWENPPDITQLNLEPYSVDTICQQ
YLELNNKLKHFTDLSDRKITL