Protein Info for LU632_RS17915 in Erwinia tracheiphila SCR3

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 9 to 386 (378 residues), 612.4 bits, E=3e-188
• PF00155: Aminotran_1_2
  • amino acids 91 to 370 (280 residues), 34.6 bits, E=1.3e-12

Best Hits

Swiss-Prot: 90% identical to GLYA_ERWT9: Serine hydroxymethyltransferase (glyA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 94% identity to ebi:EbC_33940)

MetaCyc: 89% identical to serine hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
4.1.2.-; Glycine hydroxymethyltransferase. [EC: 2.1.2.1]; RXN-6321 [EC: 2.1.2.1]; RXN0-5240 [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• folate transformations II (plants) (9/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• glycine degradation (3/3 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• glycine betaine degradation I (5/8 steps found)
• glycine betaine degradation III (4/7 steps found)
• photorespiration II (6/10 steps found)
• folate transformations I (8/13 steps found)
• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• purine nucleobases degradation II (anaerobic) (11/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.1

Protein Sequence (417 amino acids)

>LU632_RS17915 serine hydroxymethyltransferase (Erwinia tracheiphila SCR3)
MLKRDMNVADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYP
GKRYYGGCEYVDIVEQLAIDRAKAVFGADFANVQPHSGSQANFAVYTALLQPGDTILGMN
LAHGGHLTHGSPVNFSGKLYNVVPYGIDETGHIDYDNLAAQAQKHKPKMIIGGFSAYSGV
CDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHIVTTTTHKTLAGPRGGLIL
AKDGDEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVVKNAKAMVE
VFLERGYKVISGGTHNHLFLLDLVDKNLTGKEADVALGRANITVNKNSVPNDPKSPFVTS
GIRIGSPAVTRRGFQEAEVRQLAGWISDILDNINDQDVQERVKKQVLEICERFPVYA