Protein Info for GFF677 in Pseudomonas sp. DMC3

Annotation: Tryptophan synthase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR00262: tryptophan synthase, alpha subunit" amino acids 8 to 260 (253 residues), 265.1 bits, see alignment E=2.1e-83 PF00290: Trp_syntA" amino acids 8 to 263 (256 residues), 339 bits, see alignment E=2.1e-105

Best Hits

Swiss-Prot: 96% identical to TRPA_PSEPF: Tryptophan synthase alpha chain (trpA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: None (inferred from 100% identity to oaa:100086253)

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF677 Tryptophan synthase alpha chain (Pseudomonas sp. DMC3)
MSRLQTRFADLKQQNRAALVTFVTAGDPDYDTSLAILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALGAKQNLAKTLQMVREFREGNSDTPLVLMGYFNPIHKFGVERFIAEAKE
AGVDGLIVVDMPPEHNEELCDPAQAAGLDFIRLTTPTTDDARLPRVLNGSSGFVYYVSVA
GVTGAGAATLEHVEEAVARLRRHTDLPISIGFGIRTPEQAAAIARLADGVVVGSALIDHI
ASADTPEQAIDGVLSLCSALSQGVRKARV