Protein Info for GFF4129 in Sphingobium sp. HT1-2

Annotation: Chromosome (plasmid) partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 49 to 215 (167 residues), 202.3 bits, see alignment E=3e-64 PF02195: ParBc" amino acids 52 to 139 (88 residues), 103.1 bits, see alignment E=1.1e-33 PF17762: HTH_ParB" amino acids 189 to 237 (49 residues), 56 bits, see alignment 4.3e-19 PF23552: ParB_dimer" amino acids 256 to 304 (49 residues), 62.7 bits, see alignment 2.7e-21

Best Hits

Swiss-Prot: 48% identical to PARB_CAUVN: Chromosome-partitioning protein ParB (parB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 79% identity to sch:Sphch_2258)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF4129 Chromosome (plasmid) partitioning protein ParB (Sphingobium sp. HT1-2)
LSDEIGEKQKPVKRPHGLGRGLSALLGDVSREEPVAASANSAAPSSKAVQNIEVALIQPH
PEQPRRHFDQDALQELADSIAKRGVIQPIIVRPHGGGFQIVAGERRWRAAQKAQLHRIPA
IVRDFDEQETLEIALVENIQREDLNPIEEAEAYRKLIGEFHHSQEALGRIVGKSRSHIAN
LMRLLDLPDPVQQAVSHGRISMGHARALIGVPGCESMALMVEQKGLSVRETEQLVRKTKK
GEDAEPKSRGATPGGKDADIAALEQHLADILGLKVEIADSGDGPGTLSLRYSTLDQLDML
CQRLSGERI