Protein Info for GFF1274 in Sphingobium sp. HT1-2

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 76 to 108 (33 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 2 to 172 (171 residues), 110.7 bits, see alignment E=4.6e-36 TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 3 to 181 (179 residues), 138.2 bits, see alignment E=2.2e-44

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 94% identity to sjp:SJA_C1-22780)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>GFF1274 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (Sphingobium sp. HT1-2)
MLTLPNLLTLSRIITVPLLVALLWPGEMGARWTTGYGLAFGLYCLMGITDYFDGYLARAQ
GAVSKLGVFLDPIADKIMVGAVILMLAATRDIAGIHIAAAMIILLREIAVSGLREFLAGL
QVSVPVSRLAKWKTTFQLIALGALILAGAVPQFPFVQSVGILTLWAAAILTLITGWDYLR
VGIKHMD