Protein Info for GFF123 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional repressor for pyruvate dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00392: GntR" amino acids 12 to 74 (63 residues), 88.5 bits, see alignment E=1.8e-29 PF07729: FCD" amino acids 99 to 226 (128 residues), 63.3 bits, see alignment E=3e-21

Best Hits

Swiss-Prot: 100% identical to PDHR_SALTS: Pyruvate dehydrogenase complex repressor (pdhR) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 100% identity to ses:SARI_02843)

Predicted SEED Role

"Transcriptional repressor for pyruvate dehydrogenase complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>GFF123 Transcriptional repressor for pyruvate dehydrogenase complex (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFDVSRPSLREAIQRLEA
KGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLETRHALEGIAAYYAALRST
DEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEAAHNVVLLHLLRCMEPMLAQN
VRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAREASHRHLAFIEEIMLDRSREES
RRERALRRLEQRKN