Protein Info for GEMAOFIL_03210 in Pseudomonas lactucae CFBP13502

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details PF05227: CHASE3" amino acids 43 to 174 (132 residues), 76.5 bits, see alignment E=8.9e-25 TIGR00229: PAS domain S-box protein" amino acids 261 to 386 (126 residues), 79.1 bits, see alignment E=1.5e-26 PF00989: PAS" amino acids 266 to 377 (112 residues), 34.3 bits, see alignment E=9.5e-12 PF13426: PAS_9" amino acids 278 to 379 (102 residues), 50.3 bits, see alignment E=1.1e-16 PF08448: PAS_4" amino acids 278 to 382 (105 residues), 36.4 bits, see alignment E=2.4e-12 PF08447: PAS_3" amino acids 289 to 370 (82 residues), 26.5 bits, see alignment E=2.9e-09 PF00512: HisKA" amino acids 400 to 464 (65 residues), 67 bits, see alignment E=5.5e-22 PF02518: HATPase_c" amino acids 512 to 618 (107 residues), 90.2 bits, see alignment E=5.4e-29 PF00072: Response_reg" amino acids 651 to 762 (112 residues), 71 bits, see alignment E=4.3e-23

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfs:PFLU2937)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (771 amino acids)

>GEMAOFIL_03210 Sensor histidine kinase RcsC (Pseudomonas lactucae CFBP13502)
MKRRWADLPLRGKALVVISLPLVVLLLSLVLIYITERQTARAEEDVRRVLRVQGDIQAVH
TLLAEAAASVRGYLLTRREDFLPSYLNARPQIEAALHRLDRNVRDPRVREQLSAIKPLID
GKVDGLEEMLKDRDATAESIGAILISNKHILDALRQHISSMLTLEESLLAERSAAASETR
QRLLLSTWLAAICGLFGAIVAVLFLSKGIVARVQNVQRNAQRLALGQPLLAQPPEQDEIG
QLGTRLVEAGVLLAERERALRDNEERLRLIIDGVKDYGIFALDTAGHVTSWNNGAERIKG
YTEQEIIGRHFSLFYLPEECPQHPEMALREATRDGDYTEEGWRCRKDGTRFWASVVITAQ
YDGTGALRGFSKITRDITDRRAAEIALRTAREEAERASRAKSEFLSRMSHELRTPLNSIL
GFAQLLDMDAAKTQKAHVGHILRAGQHLLTLINEVLDIAKIEAGSLALNIAPLPLTQVLQ
EALTLVSPMATDAGIELQPLPTLAADIGIVADRQRLTQVLLNLLSNAIKYNRRDGQVSIE
VTVDAQRIGVSVCDCGKGIAADHLGQLFTPFERLGADPNVEGSGLGLALSKSLLENMDGQ
LHVHSQAGIGSRFTLELPWVRLHAPQSLALPLIDSELKRPAPLTGAFQGKVLCIEDNLSS
LALIETLLQRRPGIKLLSSMQGQLGLDLAAQHGPQLILLDVSLPDIDGLRVLQRLRQSPV
THATPVLMITADASDRTRLALQDAGATAVLNKPINVPAFLAHLDQYFPEPA