Protein Info for EFB2_01996 in Escherichia fergusonii Becca

Annotation: Flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 14 to 255 (242 residues), 273.5 bits, see alignment E=8.4e-86 PF01311: Bac_export_1" amino acids 14 to 246 (233 residues), 228.7 bits, see alignment E=3.6e-72

Best Hits

Swiss-Prot: 98% identical to FLIR_ECOLI: Flagellar biosynthetic protein FliR (fliR) from Escherichia coli (strain K12)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 98% identity to eco:b1950)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>EFB2_01996 Flagellar biosynthetic protein FliR (Escherichia fergusonii Becca)
MMQVTSDQWLSWLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPA
NDVPVFSFFALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPGSHL
NMPVLARIMDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIF
LNGLMLALPLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFC
EHLFSEIFNLLADIISELPLI