Protein Info for BWI76_RS17190 in Klebsiella michiganensis M5al

Annotation: TonB system transport protein TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF16031: TonB_N" amino acids 36 to 164 (129 residues), 103.7 bits, see alignment E=1.3e-33 PF03544: TonB_C" amino acids 167 to 237 (71 residues), 67.4 bits, see alignment E=1.3e-22 TIGR01352: TonB family C-terminal domain" amino acids 168 to 240 (73 residues), 75.3 bits, see alignment E=1.9e-25

Best Hits

Swiss-Prot: 83% identical to TONB_KLEAK: Protein TonB (tonB) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 85% identity to kpu:KP1_3293)

MetaCyc: 75% identical to Ton complex subunit TonB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5C2 at UniProt or InterPro

Protein Sequence (245 amino acids)

>BWI76_RS17190 TonB system transport protein TonB (Klebsiella michiganensis M5al)
MSAMTFDLPRRFPWPTLLSVVIHGGVVAALLYTSVHQVIERPSPSQPIEITMVAPADLEP
PQAAQPVVEPIVEPEPEPEPEVIPEPPKEVPVVIHKPKPKPKPKPKPKPEKKVEQPKRDV
KPAETRPASPFENTNTAPARTAPSTSTANAKPTVTAPTGPRALSRGEPSYPARAQALRIE
GNVRVKFDVTAEGRVDNVQILSAQPANMFEREVKNALRKWRYEPGKPGTGITMTIQFRLK
GVQIS