Protein Info for BWI76_RS15115 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 230 to 254 (25 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 26 to 404 (379 residues), 275 bits, see alignment E=6.9e-86 PF07690: MFS_1" amino acids 32 to 374 (343 residues), 174.9 bits, see alignment E=3.5e-55 PF00083: Sugar_tr" amino acids 63 to 147 (85 residues), 40.5 bits, see alignment E=2.6e-14

Best Hits

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4B1 at UniProt or InterPro

Protein Sequence (410 amino acids)

>BWI76_RS15115 MFS transporter (Klebsiella michiganensis M5al)
MRPKEVPAPTASTMYRDESRGLLSRKVVIVLGLLSAVAALSTDMYLPLFPAIASDLHTTP
DKVQLSITAFMVGLGIGQLFIGPLSDHYGRRKLLLGGMTLLTIASLAGAISTNIQLLIVT
RFFQGLGGAAGIVLSRAIISDLCPGTKAARYFNLVLAIQGIAPVIAPLLGGVAAWFIWPV
VFVFMAAISLVSTLLSSHFISETLPRHQRLPFNLNEFISQFIELLSHKKYIGYTLIFAIQ
FGALFAYISASPFIYQSAFDLSSGEFAVIFSINAAVMMFGSIVSARYVTKFGEDNLIIVG
VISTLVISILLCIVNYISHFQFEIAAVLLLIMMFTMALTFGNAASMAMAASSHLKGTGSA
ILGVFQFGIAAITPLLLGFGDPLSLLPMSLIIAGCCLIAIMALLLTGKKG