Protein Info for BWI76_RS08610 in Klebsiella michiganensis M5al

Annotation: galactose-1-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR02636: galactose mutarotase" amino acids 12 to 344 (333 residues), 462.6 bits, see alignment E=3.6e-143 PF01263: Aldose_epim" amino acids 17 to 343 (327 residues), 297.5 bits, see alignment E=6e-93

Best Hits

Swiss-Prot: 76% identical to GALM_ECOLI: Aldose 1-epimerase (galM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_14285)

MetaCyc: 76% identical to galactose-1-epimerase (Escherichia coli K-12 substr. MG1655)
Aldose 1-epimerase. [EC: 5.1.3.3]

Predicted SEED Role

"Aldose 1-epimerase (EC 5.1.3.3)" in subsystem Lactose and Galactose Uptake and Utilization or Maltose and Maltodextrin Utilization (EC 5.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B112 at UniProt or InterPro

Protein Sequence (347 amino acids)

>BWI76_RS08610 galactose-1-epimerase (Klebsiella michiganensis M5al)
MLNPTTELAPDGQPWNLLTLRNDAGMTVTVMDWGATLLSARVTLADGSVREALLGCANPG
DYTRQAAYLGASVGRYANRIANSRFTLDGRTVNLTPSNEAGHQLHGGPEGFDKRRWQIVS
ADDRHALFSLSSRDGDQGFPGNLTATARYRLTDDNRIAIEYRATVDQPCPVNLTNHVYFN
LDGVQSDVRSHKLQIFADAYLPVESDGIPGGDLQNVTLTSFDFRTPKVLADDFLRDEDQQ
KVKGYDHAFLLQALGDAKSPAAHVWSQDEKLQMTVYTSAPALQFYSGNYLAGTPSRTAQP
YDDWQGLALESEFLPDSPNHPEWPQPDCVLRPGEEYVSLTEYQFIAQ