Protein Info for BWI76_RS05950 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 17 to 81 (65 residues), 52.5 bits, see alignment E=2.9e-18 PF00528: BPD_transp_1" amino acids 43 to 239 (197 residues), 51.7 bits, see alignment E=4.6e-18

Best Hits

KEGG orthology group: None (inferred from 92% identity to eae:EAE_12255)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZC0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>BWI76_RS05950 polar amino acid ABC transporter inner membrane subunit (Klebsiella michiganensis M5al)
MIPHLDWHGVLSGQPLQWIISGFLTTVWVSVAGMILATVLAILLLALRLGGGRPGRWLVA
AWVSLFRNTPLLVQLLFWYFAAWNLLPLGARDFINDDHSWSILPGNVWWLTPEFLCSMWG
LGVFTSAFLIEEIASGLRAVSHGQREAALSQGFTPWQELRHILLPQGLANAWQPIIGQYL
NLMKLSSLASGIGFAELTYQVRQIESYNAHALEAFAVGTALYLALGVVMGVALTRLGPGR
NQQRRAGYER