Protein Info for BWI76_RS02050 in Klebsiella michiganensis M5al

Annotation: CidA/LrgA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details PF03788: LrgA" amino acids 31 to 122 (92 residues), 91.1 bits, see alignment E=1.8e-30

Best Hits

KEGG orthology group: None (inferred from 92% identity to eae:EAE_08585)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWK0 at UniProt or InterPro

Protein Sequence (136 amino acids)

>BWI76_RS02050 CidA/LrgA family protein (Klebsiella michiganensis M5al)
MAFALARVTPCIMQRLQVPVQVLIYAGLFVCAEYLVNWLHLPLPANLVGMLMLLALIVCR
IIPLNWVRAGARWLLAEMLLFFVPAVVAVVNYAQLLMVDGWRIFLVIGLSTMMVLGATAW
VVDKVYRYEVSRMKHE