Protein Info for Sama_0816 in Shewanella amazonensis SB2B

Annotation: cyclopropane-fatty-acyl-phospholipid synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF02353: CMAS" amino acids 133 to 396 (264 residues), 278.3 bits, see alignment E=2e-86 PF01135: PCMT" amino acids 165 to 236 (72 residues), 22.9 bits, see alignment E=2e-08 PF13489: Methyltransf_23" amino acids 175 to 299 (125 residues), 36.7 bits, see alignment E=1.1e-12 PF13649: Methyltransf_25" amino acids 193 to 286 (94 residues), 39.4 bits, see alignment E=2.5e-13 PF08241: Methyltransf_11" amino acids 193 to 289 (97 residues), 31 bits, see alignment E=1e-10 PF08242: Methyltransf_12" amino acids 193 to 287 (95 residues), 30.9 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to saz:Sama_0816)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3R7 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Sama_0816 cyclopropane-fatty-acyl-phospholipid synthase (RefSeq) (Shewanella amazonensis SB2B)
MDNTAIANKSTSSTLESLAQRILLTALKGLSYGGLRMICDGETLVFGSHQGPQAVIHVKS
PRFFREVLLAGSVGAGESFIDGHWDSPNLTEVVRLFAANLPLLDRLEKRFAFLSGVTNRI
SHLLSRNSIEGSKRNILAHYDLGNALYECFLDKSMLYSSAIYPDVNATLEVAQQHKLATI
CERLKLAPGMELLEIGTGWGALAIYAATHYGVKVTTTTISDAQHDYAKARIREAGLEGQI
TLLKKDYRLLEGKYDRLVSIEMIEAVGHEYLPGFFSKLESLLKDDGLMLLQAITIADQRY
ESYRKGCDFIQKYIFPGGCLPSVSRMANLLAQRTDMVMLSLDDIGEDYARTLKHWHENVD
REQPQIRSLGYDERFIRLWKFYLSYCEGGFWERTTSAVHLVAARPGWRP