Protein Info for Shew_2499 in Shewanella loihica PV-4

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 114 to 334 (221 residues), 121.3 bits, see alignment E=2.1e-39

Best Hits

Swiss-Prot: 36% identical to DPPB_HAEIN: Dipeptide transport system permease protein DppB (dppB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2499)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFW7 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Shew_2499 binding-protein-dependent transport systems inner membrane component (RefSeq) (Shewanella loihica PV-4)
MARYLIRRLNLFLATSLVLFLVMFIVTSKFPVEHTFALTGLQSPTAQELTQIAQDYQLDS
SQAHQFLAYLQQRLSGNLGISATSQNPVIDELTAVLPASFELGIVAGLIALVLGLPLGVL
ASLSKHKITQHTIMAITLTGYSIPVFWLGLSLSLWFGVQLGWLPISGQINLLYDIRPVTG
FLLIDTLLSDSQYATSAFIDALLHIILPAVTLAVLPFTVVVRITRAAMIAIMEQTYIKAA
EARGLHTSIIVLRHALPNAFIPVLKNLGLMLGAFASYAMVVEVIFSWPGVGAWLVSGIYQ
RDYTVIQGGILAVALIIIFLSILIEVIHTAMNPLSRKELYAAN