Protein Info for Shew_1036 in Shewanella loihica PV-4

Annotation: putative adenylate/guanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 102 to 131 (30 residues), see Phobius details PF00211: Guanylate_cyc" amino acids 155 to 330 (176 residues), 29.4 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 100% identity to slo:Shew_1036)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBQ9 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Shew_1036 putative adenylate/guanylate cyclase (RefSeq) (Shewanella loihica PV-4)
MAAFVFFRYAQTPELPQWAVGTADLATLAIYMGIIFGSLHWMSNLIADFSAINRLPYLFS
VIFKGLFLLLGATTLAYMTQFLNMWAIENHMSTLRQMLTAHILYSPSFQALIIYLVVVRV
GLAFIEQMALLVGPRILFNIGLGKYHRPRYEQRLFLYLDMVASTTHAESLGDYRFSRLIQ
DCFSLLSDTVVNNDAEIYRYMGDAVLIHWPLENGIIEDRSFNIYYEFSQQLNWQRKYFEE
QYGFVPKFKAAAHCGQVVAAVVGVQKQEISFFSDVLNTLARLQDQCNPLGQRMLISGSLQ
SLIDTGDSHYDFTNLGPIKLKGKQHSIEVYGVSPKGSNS